Overview

  • Product nameAnti-ASPRV1 antibody
  • Description
    Rabbit polyclonal to ASPRV1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig
  • Immunogen

    Synthetic peptide corresponding to internal sequence amino acids 144 - 193 (

    GEALGVYNRLSPQDQGDYGTVKEALLKAFGVPGAAPSHLPKEIVFANSMG

    ) of Human ASPRV1 (NP_690005)

  • Positive control
    • Fetal lung lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab87168 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 37 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceExpressed primarily in the granular layer of the epidermis and inner root sheath of hair follicles. In psoriatic skin, expressed throughout the stratum corneum. In ulcerated skin, expressed in the stratum granulosum of intact epidermis but almost absent from ulcerated regions. Expressed in differentiated areas of squamous cell carcinomas but not in undifferentiated tumors. The specific function of ASPRV1 is not yet known.
  • Cellular localizationMembrane; Single-pass type I membrane protein
  • Database links
  • Alternative names
    • Aspartic peptidase, retroviral like 1 antibody
    • MUNO antibody
    • SASP antibody
    • SASPase antibody
    • Skin aspartic protease antibody
    • Taps antibody
    • TPA inducible aspartic proteinase like protein antibody
    see all

Anti-ASPRV1 antibody images

  • Anti-ASPRV1 antibody (ab87168) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 37 kDa

References for Anti-ASPRV1 antibody (ab87168)

ab87168 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87168.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"