Overview

  • Product nameAnti-ATCAY antibody
    See all ATCAY primary antibodies
  • Description
    Rabbit polyclonal to ATCAY
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Chicken, Cow, Cat, Dog, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 308-357 (

    LIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVEN

    ) of Human ATCAY (NP_149053).

  • Positive control
    • ACHN cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 98% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 42 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Involvement in diseaseDefects in ATCAY are the cause of cerebellar ataxia, cayman type (ATCAY) [MIM:601238]. ATCAY is found in a population isolate on Grand Cayman Island and causes a marked psychomotor retardation and prominent nonprogressive cerebellar dysfunction including nystagmus, intention tremor, dysarthria, and wide-based ataxic gait. Hypotonia is present from early childhood.
  • Sequence similaritiesContains 1 CRAL-TRIO domain.
  • DomainThe CRAL-TRIO domain is known to bind small hydrophobic molecules.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ataxia Cayman type protein antibody
    • Ataxia, cerebellar, Cayman type antibody
    • Atcay antibody
    • ATCAY_HUMAN antibody
    • BNIP 2 homolgy antibody
    • BNIP 2 homology antibody
    • BNIP H antibody
    • BNIP-H antibody
    • Cayman ataxia antibody
    • Caytaxin antibody
    • CLAC antibody
    see all

Anti-ATCAY antibody images

  • Anti-ATCAY antibody (ab113923) at 1 µg/ml + ACHN cell lysate at 10 µg

    Predicted band size : 42 kDa

References for Anti-ATCAY antibody (ab113923)

ab113923 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"