Anti-ATF6 antibody [70B1413] - ChIP Grade (ab11909)

Overview

  • Product nameAnti-ATF6 antibody [70B1413] - ChIP Grade
    See all ATF6 primary antibodies
  • Description
    Mouse monoclonal [70B1413] to ATF6 - ChIP Grade
  • SpecificityThis antibody recognizes both full length and active/Cleaved ATF6.
  • Tested applicationsSuitable for: ICC/IF, IHC-P, IHC-Fr, IP, ChIP, Flow Cyt, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Rabbit, Hamster, Human
  • Immunogen

    Recombinant fragment corresponding to Human ATF6 aa 1-273. This monoclonal antibody was made against a partial protein containing amino acids 1-273 of human ATF6.
    Sequence:

    MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAAN ETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSY SVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPA KTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLP SAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLG

  • Positive control
    • 293, NIH3T3, mouse liver lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab11909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P Use at an assay dependent concentration.
IHC-Fr Use at an assay dependent concentration.
IP Use at an assay dependent concentration.
ChIP Use at an assay dependent concentration.
Flow Cyt Use 1µg for 106 cells. ab170190-Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.
WB Use a concentration of 1 - 5 µg/ml. Detects a band of approximately 90 kDa (predicted molecular weight: 75 kDa). Expected band sizes of endogenous protein between 66-97 kDa, transfected full length found at 97 kDa. Additional bands at 35/55 kDa have been observed which may correspond to cleavage products.

Target

  • FunctionTranscription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the bZIP family. ATF subfamily.
    Contains 1 bZIP domain.
  • DomainThe basic domain functions as a nuclear localization signal.
    The basic leucine-zipper domain is sufficient for association with the NF-Y trimer and binding to ERSE.
  • Post-translational
    modifications
    During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases.
    N-glycosylated. The glycosylation status may serve as a sensor for ER homeostasis, resulting in ATF6 activation to trigger the unfolded protein response (UPR).
    Phosphorylated in vitro by MAPK14/P38MAPK.
  • Cellular localizationEndoplasmic reticulum membrane and Nucleus. Under ER stress the cleaved N-terminal cytoplasmic domain translocates into the nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activating transcription factor 6 alpha antibody
    • Activating transcription factor 6 antibody
    • ATF 6 antibody
    • ATF6 alpha antibody
    • ATF6 antibody
    • ATF6-alpha antibody
    • ATF6A antibody
    • ATF6A_HUMAN antibody
    • cAMP dependent transcription factor ATF 6 alpha antibody
    • cAMP-dependent transcription factor ATF-6 alpha antibody
    • Cyclic AMP dependent transcription factor ATF 6 alpha antibody
    • DKFZp686P2194 antibody
    • ESTM49 antibody
    • FLJ21663 antibody
    • Processed cyclic AMP dependent transcription factor ATF 6 alpha antibody
    • Processed cyclic AMP-dependent transcription factor ATF-6 alpha antibody
    see all

Anti-ATF6 antibody [70B1413] - ChIP Grade images

  • ICC/IF image of ab11909 stained MCF7 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab11909, 10µg/ml) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-mouse IgG (H+L) ab150113) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.



  • Predicted band size : 75 kDa

    ab11909 (3ug/ml) staining of mouse ATF6 in NIH3T3 cell lysate by Western Blot. The ~36 kDa observed band has not been characterized; it may be an ATF6 breakdown/cleavage product.

  • Overlay histogram showing HeLa cells stained with ab11909 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab11909, 1µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 2µg/1x106 cells ) used under the same conditions. Acquisition of >5,000 events was performed. This antibody gave a positive signal in HeLa cells fixed with 4% paraformaldehyde (10 min)/permeabilized in 0.1% PBS-Tween used under the same conditions.

References for Anti-ATF6 antibody [70B1413] - ChIP Grade (ab11909)

This product has been referenced in:
  • Krawczyk KK  et al. Assessing the contribution of thrombospondin-4 induction and ATF6a activation to endoplasmic reticulum expansion and phenotypic modulation in bladder outlet obstruction. Sci Rep 6:32449 (2016). WB ; Mouse . Read more (PubMed: 27581066) »
  • Kwanten WJ  et al. Hepatocellular autophagy modulates the unfolded protein response and fasting-induced steatosis in mice. Am J Physiol Gastrointest Liver Physiol 311:G599-G609 (2016). Read more (PubMed: 27514483) »

See all 13 Publications for this product

Product Wall

Application Western blot
Sample Mouse Tissue lysate - whole (retina)
Gel Running Conditions Non-reduced Non-Denaturing (Native)
Loading amount 40 µg
Specification retina
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 21°C
Username

Abcam user community

Verified customer

Submitted Jun 01 2015

Application Immunohistochemistry (Frozen sections)
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1%
Sample Mouse Tissue sections (retina)
Specification retina
Permeabilization Yes - triton
Fixative Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Jan 07 2015

Application Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Antigen retrieval step Heat mediated - Buffer/Enzyme Used: Citrate pH 6
Sample Mouse Tissue sections (Lung & Heart)
Specification Lung & Heart
Permeabilization No
Fixative Formaldehyde
Username

Mr. Amos Brooks

Verified customer

Submitted Dec 22 2014

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Mouse Cell lysate - whole cell (mouse embryonic fibroblast)
Loading amount 20 µg
Specification mouse embryonic fibroblast
Gel Running Conditions Reduced Denaturing (8%)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 7% · Temperature: 20°C
Username

Mr. Dongil Kim

Verified customer

Submitted Feb 01 2013

Thank you very much for your reply.
I have raised credit note number *** for one vial of ab11909 on the order ***. The credit should be refunded back to your credit card pending approval of our accounting department. If you do have any questions a...

Read More

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products. I am sorry this product has not perform as stated on the datasheet. I have issued a free of charge block...

Read More

Thank you for your reply. I am sorry to hear this antibody is not providing satisfactory results.
Having reviewed the protocol details, I believe this product should have given satisfactory results.
I apologize for the inconvenience and am pl...

Read More

Thank you for taking time to complete our questionnaire. I am sorry to hear that this antibody is not providing satisfactory results.
The details provided will enable us to investigate this case and will provide us with vital information for monit...

Read More

Thank you for confirming these details and for your cooperation. The details provided enable us to closely monitor the quality of our products.

I am sorry this product did not perform as stated on the datasheet and for the inconvenience this h...

Read More

Hope you are doing well.

I am writing to inquire on how you are getting on? Did you have the opportunity to test the ab11909 on cancer cells and make some stainings with theab65838? Where the results good?

Please let me know whether...

Read More

1-10 of 21 Abreviews or Q&A

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"