Overview

  • Product nameAnti-ATG4C antibody
    See all ATG4C primary antibodies
  • Description
    Rabbit polyclonal to ATG4C
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cat, Dog
  • Immunogen

    Synthetic peptide sequence derived from a region within amino acids 175-224 (TISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKK S) of Human ATG4C (NP_835739).

  • Positive control
    • 721_B cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab110152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 52 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionCysteine protease required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form (form II). Form II, with a revealed C-terminal glycine, is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes.
  • Tissue specificityHighly expressed in skeletal muscle, heart, liver and testis.
  • Sequence similaritiesBelongs to the peptidase C54 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • APG4 autophagy 4 homolog C (S. cerevisiae) antibody
    • APG4 autophagy 4 homolog C antibody
    • APG4 C antibody
    • APG4-C antibody
    • APG4C antibody
    • ATG 4C antibody
    • ATG4 autophagy related 4 homolog C (S. cerevisiae) antibody
    • ATG4 autophagy related 4 homolog C antibody
    • Atg4c antibody
    • ATG4C_HUMAN antibody
    • AUT (S. cerevisiae) like 1, cysteine endopeptidase antibody
    • AUT like 1, cysteine endopeptidase (S. cerevisiae) antibody
    • AUT like 1, cysteine endopeptidase antibody
    • AUT like 3 cysteine endopeptidase antibody
    • AUT-like 3 cysteine endopeptidase antibody
    • AUTL1 antibody
    • AUTL3 antibody
    • Autophagin 3 antibody
    • Autophagin-3 antibody
    • Autophagy related 4C cysteine peptidase antibody
    • Autophagy related cysteine endopeptidase 3 antibody
    • Autophagy related protein 4 homolog C antibody
    • Autophagy-related cysteine endopeptidase 3 antibody
    • Autophagy-related protein 4 homolog C antibody
    • Cysteine protease ATG4C antibody
    • EC 3.4.22 antibody
    • FLJ14867 antibody
    • OTTHUMP00000010715 antibody
    see all

Anti-ATG4C antibody images

  • Anti-ATG4C antibody (ab110152) at 1 µg/ml + 721_B cell lysate at 10 µg

    Predicted band size : 52 kDa

References for Anti-ATG4C antibody (ab110152)

ab110152 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab110152.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"