Anti-ATP-dependent Clp protease adapter protein ClpS antibody (ab193643)

Overview

  • Product name
    Anti-ATP-dependent Clp protease adapter protein ClpS antibody
    See all ATP-dependent Clp protease adapter protein ClpS primary antibodies
  • Description
    Rabbit polyclonal to ATP-dependent Clp protease adapter protein ClpS
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant fragment corresponding to Escherichia coli ATP-dependent Clp protease adapter protein ClpS aa 1-105.
    Sequence:

    MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKF FSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHPLL CTLEK


    Database link: P0A8Q6

  • Positive control
    • DH5a lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Protein G purified
  • Purification notes
    >95%,Protein G purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 12 kDa.
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation.
  • Database links
    • Alternative names
      • ECK0872 antibody
      • JW0865 antibody
      • Regulatory protein for ClpA substrate specificity antibody
      • YljA antibody

    Images

    • Anti-ATP-dependent Clp protease adapter protein ClpS antibody (ab193643) at 2 µg/ml + DH5a lysate

      Secondary
      Goat polyclonal to Rabbit IgG at 1/10000 dilution

      Predicted band size: 12 kDa

    References

    ab193643 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193643.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up