Anti-ATP-dependent Clp protease adapter protein ClpS antibody (FITC) (ab193632)

Overview

  • Product name
    Anti-ATP-dependent Clp protease adapter protein ClpS antibody (FITC)
    See all ATP-dependent Clp protease adapter protein ClpS primary antibodies
  • Description
    Rabbit polyclonal to ATP-dependent Clp protease adapter protein ClpS (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Escherichia coli
  • Immunogen

    Recombinant full length protein corresponding to Escherichia coli ATP-dependent Clp protease adapter protein ClpS aa 1-106.
    Sequence:

    MGKTNDWLDFDQLAEEKVRDALKPPSMYKVILVNDDYTPMEFVIDVLQKF FSYDVERATQ LMLAVHYQGKAICGVFTAEVAETKVAMVNKYARENEHP LLCTLEKA


    Database link: P0A8Q6

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/100. Predicted molecular weight: 12 kDa.

Target

  • Relevance
    Involved in the modulation of the specificity of the ClpAP-mediated ATP-dependent protein degradation.
  • Database links
    • Alternative names
      • ECK0872 antibody
      • JW0865 antibody
      • Regulatory protein for ClpA substrate specificity antibody
      • YljA antibody

    References

    ab193632 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193632.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up