Anti-YME1L1 antibody (ab170123)
Key features and details
- Rabbit polyclonal to YME1L1
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-YME1L1 antibody
See all YME1L1 primary antibodies -
Description
Rabbit polyclonal to YME1L1 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human YME1L1 aa 395-600.
Sequence:MHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQ VTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVN QAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHES GHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQM DVSMGG
Database link: BC023507 -
Positive control
- WB: HepG2 and MCF7 cell lysates; IHC-P: Human colon cancer tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab170123 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/500.
|
|
WB | (1) |
1/200 - 1/1000. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa).
|
Notes |
---|
IHC-P
1/100 - 1/500. |
WB
1/200 - 1/1000. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa). |
Target
-
Function
Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1. -
Tissue specificity
High expression in cardiac and skeletal muscle mitochondria. -
Sequence similarities
In the N-terminal section; belongs to the AAA ATPase family.
In the C-terminal section; belongs to the peptidase M41 family. -
Cellular localization
Mitochondrion inner membrane. - Information by UniProt
-
Database links
- Entrez Gene: 10730 Human
- Entrez Gene: 27377 Mouse
- Omim: 607472 Human
- SwissProt: Q96TA2 Human
- SwissProt: O88967 Mouse
- SwissProt: Q925S8 Rat
- Unigene: 499145 Human
- Unigene: 74647 Human
see all -
Alternative names
- ATP dependent metalloprotease FtsH1 homolog antibody
- ATP-dependent metalloprotease FtsH1 antibody
- ATP-dependent metalloprotease YME1L1 antibody
see all
Images
-
All lanes : Anti-YME1L1 antibody (ab170123) at 1/500 dilution
Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
Predicted band size: 86 kDa
Observed band size: 86 kDa
Additional bands at: 50 kDa (possible mature (processed) protein) -
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon cancer tissue labeling YME1L1 with ab170123 at 1/100 dilution.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab170123 has been referenced in 3 publications.
- Siira SJ et al. Concerted regulation of mitochondrial and nuclear non-coding RNAs by a dual-targeted RNase Z. EMBO Rep 19:N/A (2018). PubMed: 30126926
- Ogunbileje JO et al. Hypermetabolism and hypercatabolism of skeletal muscle accompany mitochondrial stress following severe burn trauma. Am J Physiol Endocrinol Metab 311:E436-48 (2016). PubMed: 27382037
- Akman HB et al. 3'UTR shortening and EGF signaling: implications for breast cancer. Hum Mol Genet 24:6910-20 (2015). PubMed: 26395459