Anti-ATP-dependent metalloprotease YME1L1 antibody (ab170123)

Overview

  • Product name
    Anti-ATP-dependent metalloprotease YME1L1 antibody
  • Description
    Rabbit polyclonal to ATP-dependent metalloprotease YME1L1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human ATP-dependent metalloprotease YME1L1 aa 395-600.
    Sequence:

    MHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQ VTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVN QAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHES GHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQM DVSMGG


    Database link: BC023507

  • Positive control
    • HeLa, HepG2, 7721, U373, MCF7 cell lysates; Human colon cancer tissue.

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab170123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Detects a band of approximately 86 kDa (predicted molecular weight: 86 kDa).

Target

  • Function
    Putative ATP-dependent protease which plays a role in mitochondrial protein metabolism. Ensures cell proliferation, maintains normal cristae morphology and complex I respiration activity, promotes antiapoptotic activity and protects mitochondria from the accumulation of oxidatively damaged membrane proteins. Requires to control the accumulation of nonassembled respiratory chain subunits (NDUFB6, OX4 and ND1). Seems to act in the processing of OPA1.
  • Tissue specificity
    High expression in cardiac and skeletal muscle mitochondria.
  • Sequence similarities
    In the N-terminal section; belongs to the AAA ATPase family.
    In the C-terminal section; belongs to the peptidase M41 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP dependent metalloprotease FtsH1 homolog antibody
    • ATP-dependent metalloprotease FtsH1 antibody
    • ATP-dependent zinc metalloprotease YME1L1 antibody
    • FTSH1 antibody
    • Meg-4 antibody
    • MEG4 antibody
    • PAMP antibody
    • Presenilin-associated metalloprotease antibody
    • UNQ1868/PRO4304 antibody
    • YME1 like 1 antibody
    • YME1-like protein 1 antibody
    • YME1L antibody
    • Yme1l1 antibody
    • YMEL1_HUMAN antibody
    see all

Images

  • All lanes : Anti-ATP-dependent metalloprotease YME1L1 antibody (ab170123) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : HepG2 cell lysate
    Lane 3 : 7721 cell lysate
    Lane 4 : U373 cell lysate
    Lane 5 : MCF7 cell lysate

    Predicted band size: 86 kDa
    Observed band size: 86 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon cancer tissue labeling ATP-dependent metalloprotease YME1L1 with ab170123 at 1/100 dilution.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up