Overview

  • Product name
  • Description
    Rabbit polyclonal to ATP10A
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ATP10A aa 1301-1386.
    Sequence:

    PTQLQLARQLTRKSPRRCSAPKETFAQGRLPKDSGTEHSSGRTVKTSVPL SQPSWHTQQPVCSLEASGEPSTVDMSMPVREHTLLE


    Database link: O60312

  • Positive control
    • Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab184801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity
    Widely expressed, with highest levels in kidney, followed by lung, brain, prostate, testis, ovary and small intestine.
  • Involvement in disease
    Angelman syndrome
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily.
  • Cellular localization
    Cell membrane. Endoplasmic reticulum membrane. Exit from the endoplasmic reticulum requires the presence of TMEM30A, but not that of TMEM30B.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP10A antibody
    • Aminophospholipid translocase VA antibody
    • AT10A_HUMAN antibody
    • Atp10a antibody
    • ATP10C antibody
    • ATPase class V type 10A antibody
    • ATPase Class V type 10C antibody
    • ATPase type IV phospholipid transporting (P type) antibody
    • ATPVA antibody
    • ATPVC antibody
    • KIAA0566 antibody
    • Phospholipid transporting ATPase VA antibody
    • Probable phospholipid-transporting ATPase VA antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human kidney tissue labeling ATP10A with ab184801 at 1/50 dilution.

References

ab184801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184801.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up