Overview

  • Product name
  • Description
    Rabbit polyclonal to ATP6V0A1
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Orangutan, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human ATP6V0A1 aa 209-387.
    Sequence:

    PVTGDYVHKSVFIIFFQGDQLKNRVKKICEGFRASLYPCPETPQERKEMA SGVNTRIDDLQMVLNQTEDHRQRVLQAAAKNIRVWFIKVRKMKAIYHTLN LCNIDVTQKCLIAEVWCPVTDLDSIQFALRRGTEHSGSTVPSILNRMQTN QTPPTYNKTNKFTYGFQNIVDAYGIGTYR


    Database link: Q93050

  • Positive control
    • K562 cell lysate; Human fetal kidney tissue.

Properties

  • Form
    Lyophilised:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary.
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab176858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 96 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function
    Required for assembly and activity of the vacuolar ATPase. Potential role in differential targeting and regulation of the enzyme for a specific organelle.
  • Sequence similarities
    Belongs to the V-ATPase 116 kDa subunit family.
  • Cellular localization
    Cytoplasmic vesicle membrane. Melanosome. Coated vesicle. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt
  • Database links
  • Alternative names
    • a1 antibody
    • ATP6N1 antibody
    • ATP6N1A antibody
    • ATP6V0A1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) non catalytic accessory protein 1A (110/116kD) antibody
    • ATPase H+ transporting lysosomal non catalytic accessory protein 1 (110/116kD) antibody
    • ATPase H+ transporting lysosomal V0 subunit a1 antibody
    • ATPase H+ transporting V0 subunit a1 antibody
    • ATPase, H+ transporting, lysosomal, noncatalytic accessory protein 1A antibody
    • Clathrin coated vesicle/synaptic vesicle proton pump 116 kDa subunit antibody
    • Clathrin-coated vesicle/synaptic vesicle proton pump 116 kDa subunit antibody
    • DKFZp781J1951 antibody
    • H(+) transporting two sector ATPase 116 kDa accessory protein A1 antibody
    • Stv1 antibody
    • V ATPase 116 kDa antibody
    • V ATPase 116 kDa isoform a1 antibody
    • V type proton ATPase 116 kDa subunit a antibody
    • V type proton ATPase 116 kDa subunit a isoform 1 antibody
    • V-ATPase 116 kDa isoform a1 antibody
    • V-type proton ATPase 116 kDa subunit a isoform 1 antibody
    • Vacuolar adenosine triphosphatase subunit Ac116 antibody
    • Vacuolar proton pump subunit 1 antibody
    • Vacuolar proton pump, subunit 1 antibody
    • Vacuolar proton translocating ATPase 116 kDa subunit A antibody
    • Vacuolar proton translocating ATPase 116 kDa subunit a isoform 1 antibody
    • Vacuolar type H(+) ATPase 115 kDa subunit antibody
    • Vph1 antibody
    • VPP1 antibody
    • VPP1_HUMAN antibody
    see all

Images

  • Anti-ATP6V0A1 antibody (ab176858) at 1/500 dilution + K562 cell lysate

    Predicted band size : 96 kDa
  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human fetal kidney tissue labeling ATP6V0A1 with ab176858 at a 1/100 dilution.

References

ab176858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Mouse Cell lysate - whole cell (MCD4 (mouse collecting duct cell line))
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
15 µg
Specification
MCD4 (mouse collecting duct cell line)
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 20°C
Username

Abcam user community

Verified customer

Submitted Aug 31 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up