Overview

  • Product nameAnti-ATP6V1C1 antibody
    See all ATP6V1C1 primary antibodies
  • Description
    Rabbit polyclonal to ATP6V1C1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 72-121 (

    VAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNI

    ) of Human TP6V1C1 (NP_001686).

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionSubunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the V-ATPase C subunit family.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP6C antibody
    • ATP6D antibody
    • ATP6V1C1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD antibody
    • ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C1 antibody
    • ATPase H+ transporting lysosomal V1 subunit C1 antibody
    • FLJ20057 antibody
    • H(+) transporting two sector ATPase subunit C antibody
    • H+ ATPase C subunit antibody
    • H+ transporting ATPase chain C vacuolar antibody
    • Subunit C of vacuolar proton ATPase V1 domain antibody
    • V ATPase C subunit antibody
    • V ATPase subunit C 1 antibody
    • V-ATPase subunit C 1 antibody
    • V-type proton ATPase subunit C 1 antibody
    • Vacuolar ATP synthase subunit C antibody
    • Vacuolar proton pump 42 kD subunit antibody
    • Vacuolar proton pump C subunit antibody
    • Vacuolar proton pump subunit C 1 antibody
    • Vacuolar protonATPase subunit C VI domain antibody
    • VATC antibody
    • VATC1_HUMAN antibody
    • VATPase C subunit antibody
    • VATPase subunit C 1 antibody
    • VMA5 antibody
    see all

Anti-ATP6V1C1 antibody images

  • Anti-ATP6V1C1 antibody (ab87163) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 44 kDa
    Observed band size : 44 kDa
    Additional bands at : 55 kDa. We are unsure as to the identity of these extra bands.

References for Anti-ATP6V1C1 antibody (ab87163)

ab87163 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"