Overview

  • Product name
  • Description
    Rabbit polyclonal to ATP6V1C1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 72-121 (

    VAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKNI

    ) of Human TP6V1C1 (NP_001686).

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab87163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit C is necessary for the assembly of the catalytic sector of the enzyme and is likely to have a specific function in its catalytic activity. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the V-ATPase C subunit family.
  • Information by UniProt
  • Database links
  • Alternative names
    • ATP6C antibody
    • ATP6D antibody
    • ATP6V1C1 antibody
    • ATPase H+ transporting lysosomal (vacuolar proton pump) 42kD antibody
    • ATPase H+ transporting lysosomal 42kD V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C isoform 1 antibody
    • ATPase H+ transporting lysosomal 42kDa V1 subunit C1 antibody
    • ATPase H+ transporting lysosomal V1 subunit C1 antibody
    • FLJ20057 antibody
    • H(+) transporting two sector ATPase subunit C antibody
    • H+ ATPase C subunit antibody
    • H+ transporting ATPase chain C vacuolar antibody
    • Subunit C of vacuolar proton ATPase V1 domain antibody
    • V ATPase C subunit antibody
    • V ATPase subunit C 1 antibody
    • V-ATPase subunit C 1 antibody
    • V-type proton ATPase subunit C 1 antibody
    • Vacuolar ATP synthase subunit C antibody
    • Vacuolar proton pump 42 kD subunit antibody
    • Vacuolar proton pump C subunit antibody
    • Vacuolar proton pump subunit C 1 antibody
    • Vacuolar protonATPase subunit C VI domain antibody
    • VATC antibody
    • VATC1_HUMAN antibody
    • VATPase C subunit antibody
    • VATPase subunit C 1 antibody
    • VMA5 antibody
    see all

Images

  • Anti-ATP6V1C1 antibody (ab87163) at 1 µg/ml (in 5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 44 kDa
    Observed band size : 44 kDa
    Additional bands at : 55 kDa. We are unsure as to the identity of these extra bands.

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab87163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up