Anti-ATP8A1 antibody - N-terminal (ab185113)

Overview

  • Product name
    Anti-ATP8A1 antibody - N-terminal
  • Description
    Rabbit polyclonal to ATP8A1 - N-terminal
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ATP8A1 aa 1-69 (N terminal).
    Sequence:

    MPTMRRTVSEIRSRAEGYEKTDDVSEKTSLADQEEVRTIFINQPQLTKFC NNHVSTAKYNIITFLPRFL


    Database link: Q9Y2Q0

  • Positive control
    • Human breast tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab185113 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May play a role in the transport of aminophospholipids from the outer to the inner leaflet of various membranes and the maintenance of asymmetric distribution of phospholipids, mainly in secretory vesicles.
  • Tissue specificity
    Found in most adult tissues except liver, testis and placenta. Most abundant in heart, brain and skeletal muscle. Also detected in fetal tissues. Isoform 1 is only detected in brain, skeletal muscle and heart and is the most abundant form in skeletal muscle.
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AT8A1_HUMAN antibody
    • Atp8a1 antibody
    • ATPase class I type 8A member 1 antibody
    • ATPASEI antibody
    • ATPIA antibody
    • ATPP2 antibody
    • Chromaffin granule ATPase II antibody
    • Probable phospholipid-transporting ATPase IA antibody
    see all

Images

  • Immunohistochemical analysis of Paraffin-embedded Human breast tissue labeling ATP8A1 with ab185113 at 1/50 dilution.

References

ab185113 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185113.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up