Overview

  • Product name
  • Description
    Rabbit polyclonal to ATXN7L3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human ATXN7L3 aa 201-272. Numbering is from isoform 1; the sequence also occurs in isoform 2.
    Sequence:

    LRSLLTTQCGVISEHTKKMCTRSLRCPQHTDEQRRTVRIYFLGPSAVLPE VESSLDNDSFDMTDSQALISRL


    Database link: Q14CW9

  • Positive control
    • Human small intestine tissue and SH-SY5Y cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab221462 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. Within the complex, it is required to recruit USP22 and ENY2 into the SAGA complex.
  • Sequence similarities
    Belongs to the SGF11 family.
    Contains 1 SCA7 domain.
    Contains 1 SGF11-type zinc finger.
  • Domain
    The long N-terminal helix forms part of the 'assembly lobe' of the SAGA deubiquitination module.
    The C-terminal SGF11-type zinc-finger domain together with the C-terminal catalytic domain of USP22 forms the 'catalytic lobe' of the SAGA deubiquitination module.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • AT7L3_HUMAN antibody
    • Ataxin 7 like 3 antibody
    • Ataxin 7 like protein 3 antibody
    • Ataxin-7-like protein 3 antibody
    • atxn7l3 antibody
    • SAGA associated factor 11 homolog antibody
    • SAGA-associated factor 11 homolog antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human small intestine tissue labeling ATXN7L3 with ab221462 at 1/1000 dilution.

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SH-SY5Y cells labeling ATXN7L3 with ab221462 at 4 µg/ml.  Antibody staining is shown in green.  

References

ab221462 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221462.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up