Overview

  • Product nameAnti-Axotrophin antibody
    See all Axotrophin primary antibodies
  • Description
    Rabbit polyclonal to Axotrophin
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within middle amino acids 287-336 (

    SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP

    ) of Human Axotrophin (NP_073737)

  • Positive control
    • Placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 78 kDa (predicted molecular weight: 78 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionE3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 RING-CH-type zinc finger.
  • DomainThe RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Information by UniProt
  • Database links
  • Alternative names
    • AXO antibody
    • AXOT antibody
    • Axotrophin antibody
    • E3 ubiquitin-protein ligase MARCH7 antibody
    • MARCH VII antibody
    • MARCH-VII antibody
    • March7 antibody
    • MARH7_HUMAN antibody
    • Membrane associated RING CH protein VII antibody
    • Membrane associated ring finger (C3HC4) 7 E3 ubiquitin protein ligase antibody
    • membrane associated ring finger C3HC4 7 antibody
    • Membrane associated RING finger protein 7 antibody
    • Membrane-associated RING finger protein 7 antibody
    • Membrane-associated RING-CH protein VII antibody
    • RING finger protein 177 antibody
    • RNF177 antibody
    see all

Anti-Axotrophin antibody images

  • Anti-Axotrophin antibody (ab84130) at 1 µg/ml + Placental lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 78 kDa
    Observed band size : 78 kDa

References for Anti-Axotrophin antibody (ab84130)

ab84130 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"