Overview

  • Product name
  • Description
    Rabbit polyclonal to Axotrophin
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within middle amino acids 287-336 (

    SSMSSTFFSRRSSQDSLNTRSLNSENSYVSPRILTASQSRSNVPSASEVP

    ) of Human Axotrophin (NP_073737)

  • Positive control
    • Placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab84130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 78 kDa (predicted molecular weight: 78 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    E3 ubiquitin-protein ligase which may specifically enhance the E2 activity of HIP2. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Contains 1 RING-CH-type zinc finger.
  • Domain
    The RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Information by UniProt
  • Database links
  • Alternative names
    • AXO antibody
    • AXOT antibody
    • Axotrophin antibody
    • E3 ubiquitin-protein ligase MARCH7 antibody
    • MARCH VII antibody
    • MARCH-VII antibody
    • March7 antibody
    • MARH7_HUMAN antibody
    • Membrane associated RING CH protein VII antibody
    • Membrane associated ring finger (C3HC4) 7 E3 ubiquitin protein ligase antibody
    • membrane associated ring finger C3HC4 7 antibody
    • Membrane associated RING finger protein 7 antibody
    • Membrane-associated RING finger protein 7 antibody
    • Membrane-associated RING-CH protein VII antibody
    • RING finger protein 177 antibody
    • RNF177 antibody
    see all

Images

  • Anti-Axotrophin antibody (ab84130) at 1 µg/ml + Placental lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 78 kDa
    Observed band size : 78 kDa

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up