Overview

  • Product name
  • Description
    Rabbit polyclonal to B3GALT5
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human B3GALT5 aa 26-80.
    Sequence:

    YSLNPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMA IRQTW


    Database link: Q9Y2C3

  • Positive control
    • Human stomach tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab185371 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Catalyzes the transfer of Gal to GlcNAc-based acceptors with a preference for the core3 O-linked glycan GlcNAc(beta1,3)GalNAc structure. Can use glycolipid LC3Cer as an efficient acceptor.
  • Tissue specificity
    Expressed in stomach, jejunum, colon, pancreas, small intestine, testis and gastrointestinal and pancreatic cancer cell lines. Hardly detected in lung, liver, adrenal gland and peripheral blood leukocytes.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3-galactosyltransferase 5 antibody
    • 3-GalTase 5 antibody
    • b3Gal-T5 antibody
    • B3GalT-V antibody
    • B3GALT5 antibody
    • B3GalTx antibody
    • B3GT5_HUMAN antibody
    • B3T5 antibody
    • Beta-1 antibody
    • Beta-1,3-Gal Tase 5 antibody
    • Beta-1,3-galactosyltransferase 5 antibody
    • beta-1,3-GalTase 5 antibody
    • beta-3-galactosyltransferase 5 antibody
    • Beta-3-Gx-T5 antibody
    • Beta3Gal-T5 antibody
    • Beta3GalT5 antibody
    • GLCT5 antibody
    • Homolog of C. elegans Bt toxin resistance gene bre-5 antibody
    • UDP-Gal:beta-GlcNAc beta-1 antibody
    • UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5 antibody
    • UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1 antibody
    • UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5 antibody
    see all

Images

  • Immunohistochemical analysis of Human stomach tissue labeling B3GALT5 with ab185371 at 1/50 dilution.

References

ab185371 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185371.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up