Overview

  • Product name
  • Description
    Rabbit polyclonal to B3GNT4
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human B3GNT4 aa 60-125.
    Sequence:

    TAHQPFWAPPTPRHSRCPPNHTVSSASLSLPSRHRLFLTYRHCRNFSILL EPSGCSKDTFLLLAIK


    Database link: Q9C0J1

  • Positive control
    • Human cerebral cortex tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate.
  • Cellular localization
    Golgi Apparatus membrane; Single-pass type II membrane protein
  • Database links
  • Alternative names
    • B3GN T4 antibody
    • Beta 1,3 Gn T4 antibody
    • Beta 1,3 N acetylglucosaminyltransferase 4 antibody
    • Beta 1,3 N acetylglucosaminyltransferase bGn T4 antibody
    • Beta3Gn T4 antibody
    • BGnT4 antibody
    • EC 2.4.1.- antibody
    • UDP GlcNAc:betaGal beta 1,3 N acetylglucosaminyltransferase 4 antibody
    see all

Images

  • Immunohistochemical analysis of Human cerebral cortex tissue labeling B3GNT4 with ab188124 at 1/50.

References

ab188124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up