Overview

  • Product name
    Anti-B3GNT7 antibody
  • Description
    Rabbit polyclonal to B3GNT7
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human B3GNT7 aa 262-291 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. (NP_660279.1).
    Sequence:

    NLFVGDVLQHARPIRRKDNKYYIPGALYGK


    Database link: Q8NFL0

  • Positive control
    • Human skin tissue; mouse heart lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/100.
WB 1/1000. Predicted molecular weight: 46 kDa.

Target

  • Function
    May be involved in keratane sulfate biosynthesis. Transfers N-acetylgalactosamine on to keratan sulfate-related glycans. May play a role in preventing cells from migrating out of the original tissues and invading surrounding tissues.
  • Pathway
    Protein modification; protein glycosylation.
  • Sequence similarities
    Belongs to the glycosyltransferase 31 family.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3-Gn-T7 antibody
    • 3-N-acetylglucosaminyltransferase 7 antibody
    • B3GN7_HUMAN antibody
    • B3gnt7 antibody
    • Beta 1 3 N acetylglucosaminyltransferase 7 antibody
    • Beta-1 antibody
    • Beta3Gn T7 antibody
    • Beta3Gn-T7 antibody
    • beta3GnT7 antibody
    • BGnT 7 antibody
    • BGnT-7 antibody
    • UDP GlcNAc betaGal beta 1 3 N acetylglucosaminyltransferase 7 antibody
    • UDP-GlcNAc:betaGal beta-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human skin tissue labeling B3GNT7 with ab190217 at 1/50 dilution.

  • Anti-B3GNT7 antibody (ab190217) at 1/1000 dilution + Mouse heart lysate at 35 µg

    Predicted band size: 46 kDa

References

ab190217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up