Overview

  • Product name
  • Description
    Sheep polyclonal to Bcl6
  • Host species
    Sheep
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Chicken, Human
  • Immunogen

    Recombinant fragment corresponding to Mouse Bcl6 aa 522-696. (Dervied from E.coli).
    Sequence:

    NECDCRFSEEASLKRHTLQTHSDKPYKCDRCQASFRYKGNLASHKTVHTG EKPYRCNICGAQFNRPANLKTHTRIHSGEKPYKCETCGARFVQVAHLRAH VLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHCEKCNLHFRHK SQLRLHLRQKHGAITNTKVQYRVSA


    Database link: P41183

  • Positive control
    • Mouse embryonic tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab215062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Detects a band of approximately 100 kDa (predicted molecular weight: 79 kDa).

Target

  • Function
    Transcriptional repressor which is required for germinal center formation and antibody affinity maturation. Probably plays an important role in lymphomagenesis.
  • Tissue specificity
    Expressed in germinal center T and B cells and in primary immature dendritic cells.
  • Involvement in disease
    Note=Chromosomal aberrations involving BCL6 may be a cause of B-cell non-Hodgkin lymphoma. Translocation t(3;14)(q27;q32); translocation t(3;22)(q27;q11) with immunoglobulin gene regions.
    Note=A chromosomal aberration involving BCL6 may be a cause of a form of B-cell leukemia. Translocation t(3;11)(q27;q23) with POU2AF1/OBF1.
    Note=A chromosomal aberration involving BCL6 may be a cause of lymphoma. Translocation t(3;4)(q27;p11) with ARHH/TTF.
  • Sequence similarities
    Contains 1 BTB (POZ) domain.
    Contains 6 C2H2-type zinc fingers.
  • Domain
    The BTB domain mediates homodimerization. Its dimer interface mediates peptide binding such as to corepressors BCOR and NCOR2.
  • Post-translational
    modifications
    Phosphorylated by MAPK1 in response to antigen receptor activation. Phosphorylation induces its degradation by ubiquitin/proteasome pathway.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • B cell CLL/lymphoma 6 antibody
    • B cell lymphoma 6 protein antibody
    • B-cell lymphoma 5 protein antibody
    • B-cell lymphoma 6 protein antibody
    • BCL 5 antibody
    • Bcl 6 antibody
    • BCL-5 antibody
    • BCL-6 antibody
    • BCL5 antibody
    • BCL6 antibody
    • BCL6_HUMAN antibody
    • BCL6A antibody
    • cys his2 zinc finger transcription factor antibody
    • LAZ 3 antibody
    • LAZ 3 protein antibody
    • LAZ3 antibody
    • Lymphoma Associated Zinc Finger Gene On Chromosome 3 (LAZ3) antibody
    • Lymphoma associated zinc finger gene on chromosome 3 antibody
    • Protein LAZ-3 antibody
    • ZBTB 27 antibody
    • ZBTB27 antibody
    • Zinc finger and BTB domain containing protein 27 antibody
    • Zinc finger and BTB domain-containing protein 27 (ZBTB27) antibody
    • Zinc finger and BTB domain-containing protein 27 antibody
    • Zinc Finger Protein 51 (ZNF51) antibody
    • Zinc finger protein 51 antibody
    • zinc finger transcription factor BCL6S antibody
    • ZNF 51 antibody
    • ZNF51 antibody
    see all

Images

References

ab215062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up