Overview

  • Product name
  • Description
    Rabbit polyclonal to BCL7B
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Full length protein corresponding to Human BCL7B aa 1-202.
    Sequence:

    MSGRSVRAETRSRAKDDIKKVMAAIEKVRKWEKKWVTVGDTSLRIFKWVP VTDSKEKEKSKSNSSAAREPNGFPSDASANSSLLLEFQDENSNQSSVSDV YQLKVDSSTNSSPSPQQSESLSPAHTSDFRTDDSQPPTLGQEILEEPSLP SSEVADEPPTLTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTAS ES


    Database link: Q9BQE9

  • Positive control
    • BCL7B transfected 293T cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa.

Target

  • Function
    May play a role in lung tumor development or progression.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Note=BCL7B is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of BCL7B may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities
    Belongs to the BCL7 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • B cell CLL/lymphoma 7 protein family member B antibody
    • B cell CLL/lymphoma 7B antibody
    • B-cell CLL/lymphoma 7 protein family member B antibody
    • BCL 7B antibody
    • BCL7B antibody
    • BCL7B_HUMAN antibody
    see all

Images

  • All lanes : Anti-BCL7B antibody (ab172358) at 1 µg/ml

    Lane 1 : BCL7B transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated secondary antibody at 1/7500 dilution

    Predicted band size: 22 kDa

References

ab172358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up