Overview

  • Product name
    Anti-BDNF antibody [3C11]
    See all BDNF primary antibodies
  • Description
    Mouse monoclonal [3C11] to BDNF
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human BDNF aa 129-247. Full length mature form without signal peptide or propeptide. Produced in E coli.
    Sequence:

    HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGW RFIRIDTSCVCTLTIKRGR


    Database link: P23560

  • Positive control
    • Recombinant human BDNF; CHO supernatant containing BDNF; Rat hippocampal neuron culture lysate; proBDNF-expressing U2OS cells, brain tissue lysate. IHC-P: FFPE Human Hippocampus Normal
  • General notes

    For BDNF, multiple WB bands are possible and expected. The human protein has 5 isoforms (precursors: 28 – 37 kDa) and can be glycosylated (Uniprot: http://www.uniprot.org/uniprot/P23560). The mature form is expected at ~14 kDa (monomer) and the dimer at ~28 kDa.

Properties

Applications

Our Abpromise guarantee covers the use of ab203573 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.
ICC/IF Use a concentration of 2 - 20 µg/ml.

Target

  • Function
    During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability.
  • Tissue specificity
    Brain. Highly expressed in hippocampus, amygdala, cerebral cortex and cerebellum. Also expressed in heart, lung, skeletal muscle, testis, prostate and placenta.
  • Involvement in disease
    Bulimia nervosa 2
    Congenital central hypoventilation syndrome
  • Sequence similarities
    Belongs to the NGF-beta family.
  • Post-translational
    modifications
    The propeptide is N-glycosylated and glycosulfated.
    Converted into mature BDNF by plasmin (PLG).
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Abrineurin antibody
    • ANON2 antibody
    • BDNF antibody
    • BDNF_HUMAN antibody
    • Brain Derived Neurotrophic Factor antibody
    • Brain-derived neurotrophic factor antibody
    • BULN2 antibody
    • MGC34632 antibody
    • Neurotrophin antibody
    see all

Images

  • Anti-BDNF antibody [3C11] (ab203573) at 5 µg/ml + CHO supernatant containing BDNF at 10 µl

    Secondary
    HRP-conjugated goat anti-mouse

    Predicted band size : 15 kDa
  • IHC image of BDNF staining in Normal Human Hippocampus formalin fixed paraffin embedded tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab203573, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.

    For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.

    *Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre

  • All lanes : Anti-BDNF antibody [3C11] (ab203573) at 5 µg/ml

    Lane 1 : Human hippocampus
    Lane 2 : Rat hippocampus
    Lane 3 : Mouse hippocampus

    Lysates/proteins at 20 µg per lane.

    Secondary
    goat anti-mouse IgG IR-680 (green) at 1/10000 dilution

    Performed under reducing conditions.

    Predicted band size : 15 kDa
    Additional bands at : 15 kDa (possible mature (processed) protein),40 kDa (possible immature (unprocessed)).

    This blot was produced using a 4-12% Bis-tris gel under the MES buffer system. The gel was run at 200V for 35 minutes before being transferred onto a Nitrocellulose membrane at 30V for 70 minutes. The membrane was then blocked for an hour using Licor blocking buffer before being incubated with ab203573 (1/1000) overnight at 4°C.  Antibody binding was detected using goat anti-mouse IgG IR-680 (green) at a 1:10,000 dilution for 1hr at room temperature and then imaged using the Licor Odyssey CLx

  • Immunofluorescent analysis of proBDNF expressing U2OS cells labeling BDNF with ab203573 at 10 µg/mL (Left hand panel). Goat anti-mouse AlexaFluor488 was used as secondary antibody. For nuclear staining DAPI was used. Right hand panel: Negative control (non-transfected U2OS cells).

References

This product has been referenced in:
  • Shi X  et al. Therapeutic effects of paeonol on methyl-4-phenyl-1,2,3,6-tetrahydropyridine/probenecid-induced Parkinson's disease in mice. Mol Med Rep 14:2397-404 (2016). Read more (PubMed: 27484986) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203573.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up