Overview

  • Product nameAnti-BEND6 antibody
    See all BEND6 primary antibodies
  • Description
    Rabbit polyclonal to BEND6
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Rat
    Predicted to work with: Mouse, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 192-241 (

    FINDLMQVLYTNEYMATHSLTGAKSSTSRDKVVKPAMNQNEVQEIIGILK

    ) of Rat BEND6 (NP_001102262).

  • Positive control
    • Rat lung lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab113807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-BEND6 antibody images

  • Anti-BEND6 antibody (ab113807) at 1 µg/ml + Rat lung lysate at 10 µg

    Predicted band size : 31 kDa

References for Anti-BEND6 antibody (ab113807)

ab113807 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"