Anti-beta 2 Defensin antibody [B 235-I] (ab14426)


  • Product nameAnti-beta 2 Defensin antibody [B 235-I]See all beta 2 Defensin primary antibodies ...
  • Description
    Mouse monoclonal [B 235-I] to beta 2 Defensin
  • Specificityab14426 recognises synthetic beta defensin 2.
  • Tested applicationsELISA more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque Monkey
  • Immunogen

    Synthetic peptide: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP, corresponding to amino acids 4-41 of Human beta 2 Defensin.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 50mM Tris. pH 7.4
  • Concentration information loading...
  • PurityProtein L purified
  • Purification notesCell culture supernatant, protein L purified.
  • Clonality Monoclonal
  • Clone numberB 235-I
  • IsotypeIgG1
  • Research Areas


Our Abpromise guarantee covers the use of ab14426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
ELISA Use at an assay dependent dilution.


  • FunctionHas antibacterial activity.
  • Tissue specificityExpressed in the skin and respiratory tract.
  • Sequence similaritiesBelongs to the beta-defensin family. LAP/TAP subfamily.
  • Cellular localizationSecreted.
  • Target information above from: UniProt accession O15263 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • BD 2 antibody
    • BD-2 antibody
    • BD2 antibody
    • beta 2 antibody
    • Beta defensin 2 antibody
    • Beta defensin 4B antibody
    • Beta-defensin 2 antibody
    • Beta-defensin 4A antibody
    • DEF B2 antibody
    • DEF B4 antibody
    • DEFB 102 antibody
    • DEFB 2 antibody
    • DEFB 4 antibody
    • DEFB102 antibody
    • DEFB2 antibody
    • DEFB4 antibody
    • DEFB4B antibody
    • DEFB4P antibody
    • Defensin antibody
    • Defensin beta 2 antibody
    • Defensin beta 4 antibody
    • Defensin, beta 4 antibody
    • Defensin, beta 4, pseudogene antibody
    • Defensin, beta 4A antibody
    • Defensin, beta 4B antibody
    • DFB4A_HUMAN antibody
    • HBD 2 antibody
    • hBD-2 antibody
    • HBD2 antibody
    • SAP 1 antibody
    • SAP1 antibody
    • Skin antimicrobial peptide 1 antibody
    • Skin-antimicrobial peptide 1 antibody
    see all

References for Anti-beta 2 Defensin antibody [B 235-I] (ab14426)

ab14426 has not yet been referenced specifically in any publications.

Product Wall

Thank you for getting back to me with those details, it was very interesting. Unfortunately given that the source of the antisera have not been able to provide me with further details as to the synthesis of the immunising peptides it is difficult f...

Read More

Thank you for your enquiry. Further to correspondence with the source of this antiserum I have been informed that the antiserum was raised against tricycle human ß-Defensin 2 antigen. Unfortunately they could not provide details of whether the anti...

Read More

Thank you for contacting me. Unfortunately I have not been able to obtain a satisfactory answer from the source of this antiserum as yet. I will be in touch as soon as I know more details about the synthesis of the immunising peptides. I apprec...

Read More

Thank you for your enquiry and your patience. The members of the defensin family are classified based on the position of the three íntramolecular disulfide bridges between cystein residues. They are classified as alpha- and beta-defensins. We have ...

Read More