You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Anti-beta 2 Defensin antibody [B 235-I] (ab14426)

Overview

  • Product nameAnti-beta 2 Defensin antibody [B 235-I]See all beta 2 Defensin primary antibodies ...
  • Description
    Mouse monoclonal [B 235-I] to beta 2 Defensin
  • Specificityab14426 recognises synthetic beta defensin 2.
  • Tested applicationsELISA more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Macaque Monkey
  • Immunogen

    Synthetic peptide: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP, corresponding to amino acids 4-41 of Human beta 2 Defensin.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 50mM Tris. pH 7.4
  • Concentration information loading...
  • PurityProtein L purified
  • Purification notesCell culture supernatant, protein L purified.
  • Clonality Monoclonal
  • Clone numberB 235-I
  • IsotypeIgG1
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab14426 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
ELISA ELISA: Use at an assay dependent dilution.

Target

  • Alternative names
      BD 2 antibodyBD-2 antibodyBD2 antibody
      beta 2 antibodyBeta defensin 2 antibodyBeta-defensin 2 antibodyBeta-defensin 4A antibodyDEF B2 antibodyDEF B4 antibodyDEFB 102 antibodyDEFB 2 antibodyDEFB 4 antibodyDEFB102 antibodyDEFB2 antibodyDEFB4 antibodyDEFB4B antibodyDefensin antibodyDefensin beta 2 antibodyDefensin beta 4 antibodyDFB4A_HUMAN antibodyHBD 2 antibodyhBD-2 antibodyHBD2 antibodySAP 1 antibodySAP1 antibodySkin antimicrobial peptide 1 antibodySkin-antimicrobial peptide 1 antibody
    see all

References for Anti-beta 2 Defensin antibody [B 235-I] (ab14426)

ab14426 has not yet been referenced specifically in any publications.

Product Wall

Displaying 1 - 4 of 4 results for Abreviews and Q&A

Thank you for getting back to me with those details, it was very interesting. Unfortunately given that the source of the antisera have not been able to provide me with further details as to the synthesis of the immunising peptides it is difficult for ...

Read More

Thank you for your enquiry. Further to correspondence with the source of this antiserum I have been informed that the antiserum was raised against tricycle human ß-Defensin 2 antigen. Unfortunately they could not provide details of whether the antiser...

Read More

Thank you for contacting me. Unfortunately I have not been able to obtain a satisfactory answer from the source of this antiserum as yet. I will be in touch as soon as I know more details about the synthesis of the immunising peptides. I appreciat...

Read More

Thank you for your enquiry and your patience. The members of the defensin family are classified based on the position of the three íntramolecular disulfide bridges between cystein residues. They are classified as alpha- and beta-defensins. We have...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"