beta-Amyloid Peptide (1-40) (human) (ab120479)
Key features and details
- Amyloid beta (1-40) protein fragment. Implicated in Alzheimer's disease.
- CAS Number: 131438-79-4
Soluble in DMSO to 1 mg/ml.
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
beta-Amyloid Peptide (1-40) (human) -
Description
Amyloid beta (1-40) protein fragment. Implicated in Alzheimer's disease. -
CAS Number
131438-79-4 -
Chemical structure
Properties
-
Molecular weight
4329.86 -
Molecular formula
C194H295N53O58S -
Sequence
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV -
PubChem identifier
57339250 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in DMSO to 1 mg/ml.
-
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (4)
ab120479 has been referenced in 4 publications.
- Maiuolo J et al. Hydroxytyrosol-Donepezil Hybrids Play a Protective Role in an In Vitro Induced Alzheimer's Disease Model and in Neuronal Differentiated Human SH-SY5Y Neuroblastoma Cells. Int J Mol Sci 24:N/A (2023). PubMed: 37686262
- Arcone R et al. Inhibition of Enzymes Involved in Neurodegenerative Disorders and Aβ1-40 Aggregation by Citrus limon Peel Polyphenol Extract. Molecules 28:N/A (2023). PubMed: 37687161
- Kim SH et al. Development of a Low-Molecular-Weight Aβ42 Detection System Using a Enzyme-Linked Peptide Assay. Biomolecules 11:N/A (2021). PubMed: 34944462
- Zhang JX et al. Rescue of cognitive deficits in APP/PS1 mice by accelerating the aggregation of ß-amyloid peptide. Alzheimers Res Ther 11:106 (2019). PubMed: 31847879