Anti-beta Amylase antibody - BSA and Azide free (ab182887)

Overview

  • Product name
    Anti-beta Amylase antibody - BSA and Azide free
    See all beta Amylase primary antibodies
  • Description
    Rabbit polyclonal to beta Amylase - BSA and Azide free
  • Host species
    Rabbit
  • Tested applications
    Suitable for: Dot blot, WBmore details
  • Species reactivity
    Reacts with: Sweet potato
  • Immunogen

    Full length native protein (purified) corresponding to beta Amylase aa 1-499. ab182887 was isolated and purified from sweet potato. Freund’s complete adjuvant is used in the first step of the immunization procedure.
    Sequence:

    MAPIPGVMPIGNYVSLYVMLPLGVVNADNVFPDKEKVEDELKQVKAGGCD GVMVDVWWGIIEAKGPKQYDWSAYRELFQLVKKCGLKIQAIMSFHQCGGN VGDAVFIPIPQWILQIGDKNPDIFYTNRAGNRNQEYLSLGVDNQRLFQGR TALEMYRDFMESFRDNMADFLKAGDIVDIEVGCGAAGELRYPSYPETQGW VFPGIGEFQCYDKYMVADWKEAVKQAGNADWEMPGKGAGTYNDTPDKTEF FRPNGTYKTDMGKFFLTWYSNKLIIHGDQVLEEANKVFVGLRVNIAAKVS GIHWWYNHVSHAAELTAGFYNVAGRDGYRPIARMLARHHATLNFTCLEMR DSEQPAEAKSAPQELVQQVLSSGWKEYIDVAGENALPRYDATAYNQMLLN VRPNGVNLNGPPKLKMSGLT YLRLSDDLLQTDNFELFKKFVKKMHADL DPSPNAISPAVLERSNSAITIDELMEATKGSRPFPWYDVTDMPVDGSNPF D


    Database link: P10537

  • General notes

    If a slight precipitation occurs upon storage, this should be removed by centrifugation. It will not affect the performance of the product.

Properties

Applications

Our Abpromise guarantee covers the use of ab182887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Dot blot 1/1000 - 1/80000.
WB 1/1000 - 1/80000. Predicted molecular weight: 56 kDa.
IF 1/1000 - 1/8000.

(Indirect immunofluorescence)

Target

  • Relevance
    Beta Amylase is an enzyme found in the seeds of higher plants and in sweet potatoes. It hydrolyses 1,4 alpha D glucosidic linkages in polysaccharides to remove successive maltose units from the non reducing ends of the chains. Used in the structural analysis of starch and glycogen.
  • Cellular localization
    Cytoplasmic
  • Database links
    • Alternative names
      • 14 alpha D glucan maltohydrolase antibody
      • AMYB antibody
      • BMY1 antibody

    References

    ab182887 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab182887.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up