Overview

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: Whole Serum
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab14421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA Use at an assay dependent concentration.
WB Use at an assay dependent concentration. Predicted molecular weight: 8 kDa.
IHC-Fr Use at an assay dependent concentration. PubMed: 21056450

Target

  • Function
    Has bactericidal activity.
  • Tissue specificity
    Plasma.
  • Sequence similarities
    Belongs to the beta-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • BD 1 antibody
    • BD-1 antibody
    • BD1 antibody
    • beta 1 antibody
    • Beta defensin 1 antibody
    • Beta-defensin 1 antibody
    • DEFB 1 antibody
    • DEFB1 antibody
    • DEFB1_HUMAN antibody
    • DEFB101 antibody
    • Defensin antibody
    • Defensin beta 1 antibody
    • Defensin beta 1 preproprotein antibody
    • HBD 1 antibody
    • hBD-1 antibody
    • HBD1 antibody
    • MGC51822 antibody
    see all

References for Anti-beta Defensin 1 antibody (ab14421)

This product has been referenced in:
  • Tugizov SM  et al. HIV is inactivated after transepithelial migration via adult oral epithelial cells but not fetal epithelial cells. Virology 409:211-22 (2011). IHC-Fr ; Human . Read more (PubMed: 21056450) »

See 1 Publication for this product

Product Wall

Thank you for your enquiry. Human beta-1 defensin is expressed in kidney. Therefore, I would suggest you can use a human kidney whole cell lysate such as our peptide product ab30203. I have placed a link here to a reference I hope you may find usef...

Read More

Thank you very much for your enquiry. I have contacted the originator of this antibody, and they tested the antibody in ELISA using human beta Defensin 1 (aa1-36) (DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK). In this test the antibody had a titer of 1 to 300...

Read More

Thank you for your email. We source ab14421 from outside Abcam and the originator used a synthetic peptide with the sequence: Human b-Defensin 1 (aa 28-34) (YRGKAKCACMG) (underlined amino acids differ from the original sequence, they were added or subs...

Read More

Below is the ELISA protocol which the originator of ab14421 followed. If you have any additional questions, please contact us again. PROTOCOL DIRECT ELISA: REAGENTS: Coating buffer: 0,05 M Na2CO3 adjust pH to 9,6 with solid NaHCO3 Blocking buff...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up