Overview

  • Product name
    Anti-beta Defensin 3 antibody
    See all beta Defensin 3 primary antibodies
  • Description
    Mouse polyclonal to beta Defensin 3
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Full length protein corresponding to Human beta Defensin 3 aa 1-67.
    Sequence:

    MRIHYLLFALLFLFLVPVPGHGGIINTLQKYYCRVRGGRCAVLSCLPKEE QIGKCSTRGRKCCRRKK


    Database link: NP_061131.1

  • Positive control
    • beta Defensin 3 transfected 293T cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 8 kDa.

Target

  • Function
    Exhibits antimicrobial activity against Gram-positive bacteria S.aureus and S.pyogenes, Gram-negative bacteria P.aeruginosa and E.coli and the yeast C.albicans. Kills multiresistant S.aureus and vancomycin-resistent E.faecium. No significant hemolytic activity was observed.
  • Tissue specificity
    Highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. Low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine.
  • Sequence similarities
    Belongs to the beta-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • BD 3 antibody
    • BD-3 antibody
    • BD3 antibody
    • beta 103 antibody
    • Beta defensin 103A antibody
    • Beta defensin 103A precursor antibody
    • Beta defensin 3 antibody
    • Beta-defensin 103 antibody
    • Beta-defensin 3 antibody
    • D103A_HUMAN antibody
    • DEF B3 antibody
    • DEFB 103 antibody
    • DEFB 103A antibody
    • DEFB 3 antibody
    • DEFB-3 antibody
    • DEFB103 antibody
    • DEFB103A antibody
    • DEFB103B antibody
    • DEFB3 antibody
    • Defensin antibody
    • Defensin beta 103A antibody
    • Defensin beta 3 antibody
    • Defensin like protein antibody
    • Defensin-like protein antibody
    • HBD 3 antibody
    • hBD-3 antibody
    • HBD3 antibody
    • HBP 3 antibody
    • HBP3 antibody
    • mBD3 antibody
    see all

Images

  • All lanes : Anti-beta Defensin 3 antibody (ab172703) at 1 µg/ml

    Lane 1 : beta Defensin 3 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-mouse HRP at 1/2500 dilution

    Predicted band size: 8 kDa

References

ab172703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up