Overview

  • Product name
    Anti-beta Sarcoglycan antibody
    See all beta Sarcoglycan primary antibodies
  • Description
    Rabbit polyclonal to beta Sarcoglycan
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Hamster, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human beta Sarcoglycan aa 93-238.
    Sequence:

    GPNGCDSMEFHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGNNQ PIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILFSTDYETHEFHLP SGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKT


    Database link: Q16585

  • Positive control
    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for beta Sarcoglycan (green) using ab222241 at 4 µg/ml in ICC/IF.

References

ab222241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222241.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up