Anti-Bikunin antibody (ab180700)
Key features and details
- Rabbit polyclonal to Bikunin
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Bikunin antibody -
Description
Rabbit polyclonal to Bikunin -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant full length protein corresponding to Human Bikunin aa 20-352. Mature protein.
Sequence:GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLV LGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITME SYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVA QGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGGQ LVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGN NFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYGG CQGNGNKFYSEKECREYCGVPGDGDEELLRFSN
Database link: P02760 -
Positive control
- WB: CEM and U-251MG cell lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180700 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 39 kDa.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 39 kDa. |
Target
-
Function
Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.
Trypstatin is a trypsin inhibitor. -
Tissue specificity
Expressed by the liver and secreted in plasma. Alpha-1-microglobulin occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid. Inter-alpha-trypsin inhibitor is present in plasma and urine. -
Sequence similarities
In the N-terminal section; belongs to the calycin superfamily. Lipocalin family.
Contains 2 BPTI/Kunitz inhibitor domains. -
Post-translational
modificationsThe precursor is proteolytically processed into separately functioning proteins.
3-hydroxykynurenine, an oxidized tryptophan metabolite that is common in biological fluids, reacts with Cys-53, Lys-111, Lys-137, and Lys-149 to form heterogeneous polycyclic chromophores including hydroxanthommatin. The reaction by alpha-1-microglobulin is autocatalytic; the human protein forms chromophore even when expressed in insect and bacterial cells. The chromophore can react with accessible cysteines forming non-reducible thioether cross-links with other molecules of alpha-1-microglobulin or with other proteins such as Ig alpha-1 chain C region 'Cys-352'.
Heavy chains are interlinked with bikunin via a chondroitin 4-sulfate bridge to the their C-terminal aspartate.
Addition of glycosaminoglycan chondroitin sulfate, allows cross-linking between the different components. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 259 Human
- Omim: 176870 Human
- SwissProt: P02760 Human
- Unigene: 436911 Human
-
Form
Bikunin, the light chain of the proteinase inhibitors inter-alpha-inhibitor and pre-alpha-inhibitor, is synthesized in the liver. Its biological function is unclear but it has been shown to inhibit proteases and to have additional activities in vitro. Bikunin is translated as a precursor protein from the same mRNA as alpha 1-microglobulin. This cosynthesis is unique compared to other proproteins since they have no known functional connection. -
Alternative names
- Alpha 1 microglobulin/bikunin precursor antibody
- Alpha-1 microglycoprotein antibody
- AMBP antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab180700 has not yet been referenced specifically in any publications.