Anti-Bilirubin Oxidase antibody (Biotin) (ab181793)

Overview

  • Product name
    Anti-Bilirubin Oxidase antibody (Biotin)
    See all Bilirubin Oxidase primary antibodies
  • Description
    Goat polyclonal to Bilirubin Oxidase (Biotin)
  • Conjugation
    Biotin
  • Specificity
    Assay by immunoelectrophoresis resulted in a single precipition arc against anti-Biotin, anti-Goat Serum as well as purified and partially purified Myrothecium verrucaria Bilirubin Oxidase.
  • Tested applications
    Suitable for: IP, WBmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Full length native protein (purified) corresponding to Bilirubin Oxidase aa 39-572. (Myrothecium verrucaria).
    Sequence:

    VAQISPQYPMFTVPLPIPPVKQPRLTVTNPVNGQEIWYYEVEIKPFTHQV YPDLGSADLVGYDGMSPGPTFQVPRGVETVVRFINNAEAPNSVHLHGSFS RAAFDGWAEDITEPGSFKDYYYPNRQSARTLWYHDHAMHITAENAYRGQA GLYMLTDPAEDALNLPSGYGEFDIPMILTSKQYTANGNLVTTNGELNSFW GDVIHVNGQPWPFKNVEPRKYRFRFLDAAVSRSFGLYFADTDAIDTRLPF KVIASDSGLLEHPADTSLLYISMAERYEVVFDFSDYAGKTIELRNLGGSI GGIGTDTDYDNTDKVMRFVVADDTTQPDTSVVPANLRDVPFPSPTTNTPR QFRFGRTGPTWTINGVAFADVQNRLLANVPVGTVERWELINAGNGWTHPI HIHLVDFKVISRTSGNNARTVMPYESGLKDVVWLGRRETVVVEAHYAPFP GVYMFHCHNLIHEDHDMMAAFNATVLPDYGYNATVFVDPMEELWQARPYE LGEFQAQSGQFSVQAVTERIQTMAEYRPYAAADE


    Database link: Q12737

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.
  • Storage buffer
    pH: 7.20
    Preservative: 0.01% Sodium azide
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride, 1% BSA
  • Concentration information loading...
  • Purity
    IgG fraction
  • Purification notes
    ab181793 is an IgG fraction antibody purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181793 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP 1/100.
WB 1/500 - 1/5000. Predicted molecular weight: 64 kDa.

Target

  • Relevance
    Bilirubin Oxidase is an enzyme that catalyses the oxidation of bilirubin to biliverdin and other substrates. This enzyme has been expected to be used in the field of clinical pathology for the enzymatic determination of total bilirubin in serum and the treatment of jaundice and hyperbilirubinemia.

References

ab181793 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181793.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up