Anti-BLBP antibody - Neuronal Marker (ab27171)

Overview

  • Product name
    Anti-BLBP antibody - Neuronal Marker
    See all BLBP primary antibodies
  • Description
    Rabbit polyclonal to BLBP - Neuronal Marker
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-FoFr, IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human BLBP aa 15-64 (N terminal). The exact sequence is proprietary. Numbering is based off mature sequence
    Sequence:

    NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF


    Database link: O15540

Properties

Applications

Our Abpromise guarantee covers the use of ab27171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-FoFr Use at an assay dependent concentration.
IHC-P 1/100.
ICC/IF 1/200. Fix cells with paraformaldehyde and block with BSA.
WB Use a concentration of 1.25 µg/ml. Predicted molecular weight: 15 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
  • Tissue specificity
    Expressed in brain and other neural tissues.
  • Sequence similarities
    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain
    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • B FABP antibody
    • B-FABP antibody
    • BFABP antibody
    • BLBP antibody
    • Brain lipid binding protein antibody
    • Brain lipid-binding protein antibody
    • Brain-type fatty acid-binding protein antibody
    • DKFZp547J2313 antibody
    • FABP 7 antibody
    • FABP7 antibody
    • FABP7_HUMAN antibody
    • FABPB antibody
    • Fatty Acid Binding Protein 7 antibody
    • Fatty acid binding protein 7 brain antibody
    • Fatty acid binding protein brain antibody
    • Fatty acid-binding protein 7 antibody
    • Fatty acid-binding protein, brain antibody
    • Mammary derived growth inhibitor related antibody
    • Mammary-derived growth inhibitor related antibody
    • MRG antibody
    • OTTHUMP00000017119 antibody
    see all

Images

  • ab27171 at 1/200 staining human foetal neural precursors by ICC/IF. The cells were paraformaldehyde fixed, blocked with BSA and incubated with the antibody for 12 hours. An Alexa Fluor ® 594 conjugated goat anti-rabbit IgG was used as the secondary.  Human neurons and astrocytes derived from neural precursors were used as the negative control. ab27171 has weak non-specific staining of the nucleolus however staining of the cytoplasm has not been detected in negative controls.

    See Abreview

  • Lane 1 : Anti-BLBP antibody - Neuronal Marker (ab27171) at 5 µg/ml
    Lane 2 : Anti-BLBP antibody - Neuronal Marker (ab27171) at 2.5 µg/ml
    Lane 3 : Anti-BLBP antibody - Neuronal Marker (ab27171) at 1.25 µg/ml

    All lanes : Lysate prepared from human fetal brain

    Lysates/proteins at 25 µg per lane.

    Predicted band size: 15 kDa
    Observed band size: 15 kDa

References

This product has been referenced in:
  • Vecera J  et al. Neural Differentiation Is Inhibited through HIF1a/ß-Catenin Signaling in Embryoid Bodies. Stem Cells Int 2017:8715798 (2017). Read more (PubMed: 29422917) »
  • Bagasrawala I  et al. N-Methyl D-Aspartate Receptor Antagonist Kynurenic Acid Affects Human Cortical Development. Front Neurosci 10:435 (2016). Read more (PubMed: 27746712) »

See all 14 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (PFA perfusion fixed frozen sections)
Sample
Mouse Tissue sections (brain)
Antigen retrieval step
None
Permeabilization
Yes - 0.1% triton x-100
Specification
brain
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Dr. Tamar Licht

Verified customer

Submitted Jun 23 2017

Application
Western blot
Sample
Apteronotus leptorhynchus Tissue lysate - whole (Brain)
Loading amount
50 µg
Specification
Brain
Gel Running Conditions
Reduced Denaturing (4-15%)
Blocking step
Milk as blocking agent for 14 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Sep 28 2012

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Frozen sections)
Sample
Apteronotus leptorhynchus Tissue sections (Brain)
Specification
Brain
Fixative
Paraformaldehyde
Permeabilization
Yes - 0.3% Triton X-100
Blocking step
3% sheep serum,1% BSA, 1% teleostean gelatine in PBS as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 23°C
Username

Dr. Ruxandra Sirbulescu

Verified customer

Submitted Oct 05 2011

Abcam has not validated the combination of species/application used in this Abreview.
Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Rat Tissue sections (Rat embryo d16 spinal cord T/S)
Specification
Rat embryo d16 spinal cord T/S
Fixative
Formaldehyde
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: 1mM citric acid pH6
Permeabilization
No
Blocking step
BSA as blocking agent for 10 minute(s) · Concentration: 1% · Temperature: RT°C
Username

Mr. Carl Hobbs

Verified customer

Submitted Oct 16 2007

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (foetal neural precursors)
Specification
foetal neural precursors
Fixative
Paraformaldehyde
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 3%
Username

Abcam user community

Verified customer

Submitted Jan 10 2007

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up