Anti-BLOC1S1 antibody - N-terminal (ab177909)

Overview

  • Product name
    Anti-BLOC1S1 antibody - N-terminal
    See all BLOC1S1 primary antibodies
  • Description
    Rabbit polyclonal to BLOC1S1 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide within Human BLOC1S1 aa 22-71 (N terminal). The exact sequence is proprietary. NP_001478
    Sequence:

    SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN


    Database link: P78537

  • Positive control
    • Human lung tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab177909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa.

Target

Images

  • Anti-BLOC1S1 antibody - N-terminal (ab177909) at 1 µg/ml + Human lung tumor lysate at 10 µg

    Predicted band size : 17 kDa

References

ab177909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up