Overview

  • Product name
  • Description
    Rabbit polyclonal to BMPR1B
  • Tested applications
    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Chicken
  • Immunogen

    Recombinant full length protein corresponding to Human BMPR1B aa 1-502.
    Sequence:

    MLLRSAGKLNVGTKKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTD GYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERN ECNKDLHPTLPPLKNRDFVDGPIHHRALLISVTVCSLLLVLIILFCYFRY KRQETRPRYSIGLEQDETYIPPGESLRDLIEQSQSSGSGSGLPLLVQRTI AKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKS MLKLAYSSVSGLCHLHTEIFSTQGKPAIAHRDLKSKNILVKKNGTCCIAD LGLAVKFISDTNEVDIPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADM YSFGLILWEVARRCVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLR PSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDI KL


    Database link: O00238

  • Positive control
    • U251 cell extract.

Properties

Applications

Our Abpromise guarantee covers the use of ab175385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use at an assay dependent concentration.
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 57 kDa.

Target

  • Function
    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP7/OP-1 and GDF5.
  • Involvement in disease
    Defects in BMPR1B are the cause of acromesomelic chondrodysplasia with genital anomalies (AMDGA) [MIM:609441]. Acromesomelic chondrodysplasias are rare hereditary skeletal disorders characterized by short stature, very short limbs, and hand/foot malformations. The severity of limb abnormalities increases from proximal to distal with profoundly affected hands and feet showing brachydactyly and/or rudimentary fingers (knob-like fingers).
    Defects in BMPR1B are a cause of brachydactyly type A2 (BDA2) [MIM:112600]. Brachydactylies (BDs) are a group of inherited malformations characterized by shortening of the digits due to abnormal development of the phalanges and/or the metacarpals. They have been classified on an anatomic and genetic basis into five groups, A to E, including three subgroups (A1 to A3) that usually manifest as autosomal dominant traits. BDA2 was described first in a large Norwegian kindred. BDA2 is caused by mutations in BMPR1B gene and studies demonstrate that these mutations function as dominant negatives in vitro and in vivo.
  • Sequence similarities
    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 GS domain.
    Contains 1 protein kinase domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Activin receptor like kinase 6 antibody
    • Acvrlk6 antibody
    • ALK 6 antibody
    • ALK6 antibody
    • alk6tr antibody
    • BMP type-1B receptor antibody
    • BMPR IB antibody
    • BMPR-1B antibody
    • Bmpr1b antibody
    • BMPRIB antibody
    • BMR1B_HUMAN antibody
    • Bone morphogenetic protein receptor type 1B antibody
    • Bone morphogenetic protein receptor type IB antibody
    • Bone morphogenetic protein receptor type-1B antibody
    • BR 1b antibody
    • BR1b antibody
    • CDw 293 antibody
    • CDw293 antibody
    • CDw293 antigen antibody
    • CFK 43a antibody
    • CFK43a antibody
    • Serine/threonine receptor kinase antibody
    • zALK 6 antibody
    • zALK6 antibody
    see all

Images

  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab175385. Blue DAPI for nuclear staining.
  • Anti-BMPR1B antibody (ab175385) at 1/500 dilution + U251 cell extract

    Predicted band size : 57 kDa

References

This product has been referenced in:
  • O'Keeffe GW  et al. Region-specific role of growth differentiation factor-5 in the establishment of sympathetic innervation. Neural Dev 11:4 (2016). ICC . Read more (PubMed: 26878848) »

See 1 Publication for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Frozen sections)
Sample
Mouse Tissue sections (Skin)
Permeabilization
No
Specification
Skin
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 10% · Temperature: 22°C
Fixative
Paraformaldehyde
Username

Ahmar Aziz

Verified customer

Submitted Apr 05 2016

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up