Anti-Bordetella pertussis toxin antibody (FITC) (ab193527)

Overview

  • Product name
    Anti-Bordetella pertussis toxin antibody (FITC)
    See all Bordetella pertussis toxin primary antibodies
  • Description
    Rabbit polyclonal to Bordetella pertussis toxin (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Bordetella pertussis
  • Immunogen

    Recombinant full length protein corresponding to Bordetella pertussis toxin aa 35-269.
    Sequence:

    DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAF VSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGA ASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHN GITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGA CMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF


    Database link: P04977

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab193527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/50 - 1/200. Predicted molecular weight: 30 kDa.

Target

  • Relevance
    Pertussis toxin contains five different chains, S1-S5. They are organized into 2 functional subunits: A, composed of S1 (which is toxic) and B, containing S2, S3, S5, and two copies of S4 (B binds to the membrane receptors). Dimers of S2-S4 and S3-S4 are held together by S5
  • Database links
    • Alternative names
      • IAP S1 antibody
      • Islet-activating protein S1 antibody
      • NAD-dependent ADP-ribosyltransferase antibody

    References

    ab193527 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab193527.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up