Overview

  • Product name
  • Description
    Mouse polyclonal to BPNT1
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Full length protein corresponding to Human BPNT1 aa 1-261.
    Sequence:

    MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKA DRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPC PSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVI NQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSN KLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCA PEVILHAVGAS


    Database link: NP_006076.3

  • Positive control
    • BPNT1 transfected 293T cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.20
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172551 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa.

Target

  • Function
    Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4-trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6.
  • Tissue specificity
    Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle.
  • Sequence similarities
    Belongs to the inositol monophosphatase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 3''(2'') antibody
    • 3'(2') 5' bisphosphate nucleotidase 1 antibody
    • 4-phosphatase antibody
    • 5''-bisphosphate nucleotidase 1 antibody
    • Bisphosphate 3 prime nucleotidase antibody
    • Bisphosphate 3' nucleotidase 1 antibody
    • Bisphosphate 3' nucleotidase antibody
    • Bisphosphate 3''-nucleotidase 1 antibody
    • Bpnt1 antibody
    • BPNT1_HUMAN antibody
    • BPntase antibody
    • PAP inositol 1,4 phosphatase antibody
    • PAP-inositol-1 antibody
    • PIP antibody
    see all

Images

  • All lanes : Anti-BPNT1 antibody (ab172551) at 1 µg/ml

    Lane 1 : BPNT1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique

    Predicted band size : 28 kDa

References

ab172551 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172551.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up