Overview

  • Product name
    Anti-BRF2 antibody - N-terminal
    See all BRF2 primary antibodies
  • Description
    Mouse polyclonal to BRF2 - N-terminal
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human, Recombinant fragment
    Predicted to work with: Mouse, Rat, Cow, Cynomolgus monkey
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human BRF2 aa 1-100 (N terminal).
    Sequence:

    MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNL REVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQA


    Database link: Q9HAW0

  • Positive control
    • BRF2 recombinant protein; Human ovarian cancer tissue lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Constituent: 50% Glycerol
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194442 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 47 kDa.

Target

Images

  • Anti-BRF2 antibody - N-terminal (ab194442) at 1/2500 dilution + BRF2 recombinant protein (immunizing peptide) at 0.2 µg

    Predicted band size: 47 kDa
    Observed band size: 37 kDa (why is the actual band size different from the predicted?)



    The observed band size may not correspond to the predicted protein molecular weight as the immunogen (recombinant fragment) was used for the test lane.

  • Anti-BRF2 antibody - N-terminal (ab194442) at 1/1000 dilution + Human ovarian cancer tissue lysate at 50 µg

    Predicted band size: 47 kDa

References

ab194442 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194442.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up