
  • Product name
  • Description
    Rabbit polyclonal to BRPF3
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide within N terminal amino acids 73-122 (CNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFRMV D) of Human BRPF3 (NP_056510)

  • Positive control
    • Jurkat cell lysate.



Our Abpromise guarantee covers the use of ab81184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 136 kDa (predicted molecular weight: 136 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.


Anti-BRPF3 antibody images

  • Anti-BRPF3 antibody (ab81184) at 1 µg/ml + Jurkat cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 136 kDa
    Observed band size : 136 kDa
    Additional bands at : 155 kDa. We are unsure as to the identity of these extra bands.

References for Anti-BRPF3 antibody (ab81184)

ab81184 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81184.
Please use the links above to contact us or submit feedback about this product.


Sign up