Overview

  • Product nameAnti-BTBD10 antibody
    See all BTBD10 primary antibodies
  • Description
    Rabbit polyclonal to BTBD10
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Dog, Zebra finch
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMS L) of Human BTBD10 (NP_115696).

  • Positive control
    • 293T nuclear lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceBTBD10 appears to behave as a suppressor of cell death, which includes neuronal cell death related to amyotrophic lateral sclerosis. It may also act as an enhancer of cell growth via its positive regulation of Akt phosphorylation.
  • Cellular localizationNuclear
  • Database links
  • Alternative names
    • BTB (broad complex tramtrack and bric a brac pox virus and zinc finger) domain containing protein 10 antibody
    • BTB (POZ) domain containing 10 antibody
    • BTB domain containing 10 antibody
    • BTB/POZ domain-containing protein 10 antibody
    • GMRP 1 antibody
    • GMRP1 antibody
    • K+ channel tetramerization protein antibody
    see all

Anti-BTBD10 antibody images

References for Anti-BTBD10 antibody (ab83085)

ab83085 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"