You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product namec-Kit protein (Active)See all c-Kit proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 26-520 of Human c-Kit expressed in modified human 293 cells; migrates as a broad band between 65 and 100 kDa. Swiss ID = P10721
  • Expression hostHEK 293 cells
  • Properties

  • Purity> 95 % by SDS-PAGE
  • Biological activityThe ED50 of ab83580 is typically 2-4 ug/ml as by its ability to neutralise SCF mediated proliferation of the human growth dependant M-07e cell line.
  • FormLyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended.
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.This product is an active protein and may elicit a biological response in vivo, handle with caution.
  • Storage bufferPreservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin
  • Concentration information loading...
  • Sequence notesTheoretical Sequence: GSSQPSVSPGEPSPPSIHPGKSDLIVRVG DEIRLLCTDPGFVKWTFEIL DETNENKQNEWITEKAEA TNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGK EDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPK AG IMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVR PAFKAVPVVSVSK ASYLLREGEEFTVTCTIKDVSSSVY STWKRENSQTKLQEKYNSWHHGDF NYERQATLTISSAR VNDSGVFMCYANNTFGSANVTTTLEVVDKGFINIF PMI NTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKW EDYPKS ENESNIRYVSELHLTRLKGTEGGTYTFLVSNS DVNAAIAFNVYVNTKPE ILTYDRLVNGMLQCVAAGFPE PTIDWYFCPGTEQRCSASVLPVDVQTLN SSGPPFGKLV VQSSIDSSAFKHNGTVECKAYNDVGKTSAYFNFAFKGNN KEQIHPHT
  • Research Areas
  • Applications

    Our Abpromise guarantee covers the use of ab83580 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    Functional Studies
    SDS-PAGE
  • Application notesFuncS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.

    Under reducing conditions ab83580 migrates as a broad band between 65 and 100 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation. This compares with unmodified c-Kit polypeptide that has a predicted monomeric molecular mass of 55.9 kDa. ab83580 consists of approximately 15-45% carbohydrate by weight.

    ab83580 separates into a number of glycoforms with a pI between 4 and 7 on 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified c-Kit that has a predicted pI of 6.1.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Protein info

    • Alternative names
        C Kitc-KitCD117
        KITKIT oncogeneKIT_HUMANMast cell growth factor receptorMast/stem cell growth factor receptorMast/stem cell growth factor receptor Kitp145 c-kitPBTPiebald trait proteinProto oncogene c KitProto oncogene tyrosine protein kinase KitProto-oncogene c-KitSCF ReceptorSCFRsoluble KIT variant 1Steel Factor ReceptorStem cell factor receptortyrosine protein kinase KitTyrosine-protein kinase Kitv kit Hardy Zuckerman 4 feline sarcoma viral oncogene homologv kit Hardy Zuckerman 4 feline sarcoma viral oncogene like proteinv-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
      see all
  • FunctionTyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
  • Tissue specificityIsoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells.
  • Involvement in diseaseDefects in KIT are a cause of piebald trait (PBT) [MIM:172800]; also known as piebaldism. PBT is an autosomal dominant genetic developmental abnormality of pigmentation characterized by congenital patches of white skin and hair that lack melanocytes.
    Defects in KIT are a cause of gastrointestinal stromal tumor (GIST) [MIM:606764].
    Defects in KIT have been associated with testicular germ cell tumor (TGCT) [MIM:273300]. A common solid malignancy in males. Germ cell tumors of the testis constitute 95% of all testicular neoplasms.
    Defects in KIT are a cause of acute myelogenous leukemia (AML) [MIM:601626]. AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development. Note=Somatic mutations that lead to constitutive activation of KIT are detected in AML patients. These mutations fall into two classes, the most common being in-frame internal tandem duplications of variable length in the juxtamembrane region that disrupt the normal regulation of the kinase activity. Likewise, point mutations in the kinase domain can result in a constitutively activated kinase.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
    Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.
  • Cellular localizationCell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head.
  • Target information above from: UniProt accession P10721 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    c-Kit protein (Active) images

    • Densitometry of protein isoforms visualised by 2-DE. The densitometry scan demonstrates that the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification. The triangle indicates the theoretical MW and pI of the protein.
    • 1D SDS-PAGE of ab83580 before and after treatment with glycosidases to remove oligosaccharides.
      Lane 1 – MW markers; Lane 2 – ab83580; Lane 3 – ab83580 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83580 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane.

      Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
    • A sample of ab83580 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 µg of protein was loaded; Gel was stained using coloidal Coomassie Brilliant Blue. Spot train indicates presence of multiple glycoforms of c-Kit.

    References for c-Kit protein (Active) (ab83580)

    ab83580 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab83580.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"