Overview

  • Product name
  • Description
    Rabbit polyclonal to C10orf57
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide designed within residues:

    QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH

    , corresponding to internal amino acids 36-85 of Human C10orf57

  • Positive control
    • HeLa cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab85395 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The exact function of C10orf57 is not known. The gene has been mapped to a region on chromosome 10q22.3 between D10S605 (78.9 Mbp) and D10S215 (89.5 Mbp).
  • Cellular localization
    Membrane, Multi-pass membrane protein
  • Database links
  • Alternative names
    • bA369J21.6 antibody
    • Chromosome 10 open reading frame 57 antibody
    • FLJ13263 antibody
    • hypothetical protein LOC80195 antibody
    • OTTHUMP00000019950 antibody
    • OTTHUMP00000019951 antibody
    • OTTHUMP00000019952 antibody
    • OTTHUMP00000019954 antibody
    • RP11-369J21.6 antibody
    • Transmembrane protein 254 antibody
    • Transmembrane protein C10orf57 antibody
    see all

Anti-C10orf57 antibody images

  • Anti-C10orf57 antibody (ab85395) at 1 µg/ml + HeLa cell lysate at 10 µg

    Predicted band size : 14 kDa

References for Anti-C10orf57 antibody (ab85395)

ab85395 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab85395.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up