
  • Product nameAnti-C11orf42 antibody
  • Description
    Rabbit polyclonal to C11orf42
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat, Horse, Guinea pig, Cow, Cat
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 259-308 (PTPPPQEGPEDKPTRFSYKGRNPFWRGPQILSENWLFSPRSPPPGAQGG G) of Human C11orf42 (NP_775796).

  • Positive control
    • MCF7 cell lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 97% PBS, 2% Sucrose
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab122967 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 36 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-C11orf42 antibody images

  • Anti-C11orf42 antibody (ab122967) at 1 µg/ml + MCF7 cell lysate at 10 µg

    Predicted band size : 36 kDa

References for Anti-C11orf42 antibody (ab122967)

ab122967 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122967.
Please use the links above to contact us or submit feedback about this product.