Overview

  • Product nameAnti-C11orf49 antibody
    See all C11orf49 primary antibodies
  • Description
    Rabbit polyclonal to C11orf49
  • Tested applicationsSuitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: VIVPTSSSGQHRQRPALGGAGTLEGVEASLFYQCLENLCDRHKYSCPPPA LVKEALSNVQ RLTFYGFLMALSKHRGINQAL, corresponding to amino acids 172-252 of Human C11orf49 (Q9H6J7).

  • Positive control
    • Human testis tissue Human cell line U 2 OS

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at -20ºC.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab122646 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. The following steps are recommended prior to antibody incubation: cells fixation in ice cold 4% paraformaldehyde pH 7.2-7.3, followed by permeabilization with 0.1% Triton X-100 in PBS for 3x5 minutes.

Target

  • Sequence similaritiesBelongs to the UPF0705 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • C11orf49 antibody
    • Chromosome 11 open reading frame 49 antibody
    • CK049_HUMAN antibody
    • FLJ22210 antibody
    • Hypothetical protein LOC79096 antibody
    • MGC4707 antibody
    • OTTHUMP00000234069 antibody
    • OTTHUMP00000234070 antibody
    • OTTHUMP00000234071 antibody
    • OTTHUMP00000234073 antibody
    • UPF0705 protein C11orf49 antibody
    see all

Anti-C11orf49 antibody images

  • ab122646, at 1/10, staining C11orf49 in paraffin embedded Human testis tissue by Immunohistochemistry.
  • ab122646, at 4 µg/ml, staining C11orf49 in Human U 2 OS cells by Immunofluorescence.

References for Anti-C11orf49 antibody (ab122646)

ab122646 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122646.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"