Overview

  • Product name
    Anti-C11orf74 antibody
  • Description
    Rabbit polyclonal to C11orf74
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 171-220 (VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSC D) of Human C11orf74, (NP_620142)

  • Positive control
    • human Fetal muscle lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The exact function of C11orf74 remains unknown.
  • Database links
  • Alternative names
    • Chromosome 11 open reading frame 74 antibody
    • FLJ38678 antibody
    • HEPIS antibody
    • Hypothetical protein LOC119710 antibody
    • Protein HEPIS antibody
    see all

Images

  • Anti-C11orf74 antibody (ab83490) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 50000

    Predicted band size : 25 kDa
    Observed band size : 25 kDa

References

ab83490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab83490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up