Overview

  • Product name
    Anti-C11orf74 antibody
  • Description
    Rabbit polyclonal to C11orf74
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 171-220 (VQLFSLDEEFDYDNVMLTSKFSPAEIENIKELCKQQKRKDTSPDLEKSC D) of Human C11orf74, (NP_620142)

  • Positive control
    • human Fetal muscle lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab83490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 25 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Relevance
    The exact function of C11orf74 remains unknown.
  • Database links
  • Alternative names
    • Chromosome 11 open reading frame 74 antibody
    • FLJ38678 antibody
    • HEPIS antibody
    • Hypothetical protein LOC119710 antibody
    • Protein HEPIS antibody
    see all

Anti-C11orf74 antibody images

  • Anti-C11orf74 antibody (ab83490) at 1 µg/ml (in 5% skim milk / PBS buffer) + Fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 50000

    Predicted band size : 25 kDa
    Observed band size : 25 kDa

References for Anti-C11orf74 antibody (ab83490)

ab83490 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up