Overview

  • Product nameAnti-C11orf80 antibody
    See all C11orf80 primary antibodies
  • Description
    Rabbit polyclonal to C11orf80
  • Tested applicationsSuitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: SYSQDMTGVTPFQMIFEVDEKPRTLMTDCLVIKHFLRKIIMVHPKVRFHF SVKVNGILSTEIFGVENEPTLNLGNGIALLVDSQHYVSRPNFGTIESHC, corresponding to amino acids 40-137 of Human C11orf80.

  • Positive control
    • Human pancreas tissue; Human plasma, Human Liver lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122519 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment

IHC-P 1/10 - 1/20. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. Perform Heat Induced Epitope Retrieval (HIER) at pH 6 using a pressure boiler as heat source.
WB 1/250 - 1/500.

Target

Anti-C11orf80 antibody images

  • Immunofluorescent staining of Human cell line A-431 shows positivity in centrosome. Recommended concentration of ab122519 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122519 at 1/15 dilution staining C11orf80 in Paraffin-embedded Human Pancreas tissue by Immunohistochemistry.
  • All lanes : Anti-C11orf80 antibody (ab122519) at 1/250 dilution

    Lane 1 : RT4 lysate
    Lane 2 : U251 MG lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique

References for Anti-C11orf80 antibody (ab122519)

ab122519 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122519.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"