
  • Product nameAnti-C12orf23 antibody
    See all C12orf23 primary antibodies
  • Description
    Rabbit polyclonal to C12orf23
  • Tested applicationsSuitable for: IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    antigen sequence: QQEIPSYLNDEPPEGSMKDHPQQQPGMLSR, corresponding to N terminal amino acids 8-37 of Human C12orf23.

  • Positive control
    • Human pancreas tissue.


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab122784 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Recommend PFA Fixation and Triton X-100 treatment


Anti-C12orf23 antibody images

  • Immunofluorescent staining of Human cell line U-2 OS shows positivity in mitochondria. Recommended concentration of ab122784 1-4 µg/ml. Cells treated with PFA/Triton X-100.
  • ab122784, at 1/50 dilution, staining C12orf23 in Paraffin Embedded Human pancreas tissue by Immunohistochemistry.

References for Anti-C12orf23 antibody (ab122784)

ab122784 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122784.
Please use the links above to contact us or submit feedback about this product.