Overview

  • Product nameAnti-C12orf24 antibody
    See all C12orf24 primary antibodies
  • Description
    Rabbit polyclonal to C12orf24
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cat
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (PPAVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTP Q) of Human C12orf24 (NP_037432).

  • Positive control
    • Human fetal heart lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81771 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 31 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceThe function of the C12orf24 protein is unknown.
  • Database links
  • Alternative names
    • Chromosome 12 open reading frame 24 antibody
    • HSU79274 antibody
    • Hypothetical protein LOC29902 antibody
    • Protein predicted by clone 23733 antibody

Anti-C12orf24 antibody images

  • Anti-C12orf24 antibody (ab81771) at 1 µg/ml + Fetal heart lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 31 kDa
    Observed band size : 33 kDa (why is the actual band size different from the predicted?)

References for Anti-C12orf24 antibody (ab81771)

ab81771 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81771.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"