Overview

  • Product nameAnti-C12ORF4 antibody
    See all C12ORF4 primary antibodies
  • Description
    Rabbit polyclonal to C12ORF4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 71-120 (EESLSDYDRDAEASLAAVKSGEVDLHQLASTWAKAYAETTLEHARPEEP S) of Human C12ORF4 (NP_065107).

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferPreservative: None
    Constituents: PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab102615 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 64 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-C12ORF4 antibody images

  • Anti-C12ORF4 antibody (ab102615) at 1 µg/ml (Anti-C12orf4 Antibody) + PANC cell lysate

    Predicted band size : 64 kDa

References for Anti-C12ORF4 antibody (ab102615)

ab102615 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102615.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"