Overview

  • Product name
    Anti-C12orf66 antibody
  • Description
    Rabbit polyclonal to C12orf66
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment within Human C12orf66 aa 176-271 (internal sequence). The exact sequence is proprietary.
    Sequence:

    HHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQT WGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSF


    Database link: Q96MD2

  • Positive control
    • Human small intestine tissue

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab184780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human small intestine labeling C12orf66 using ab184780 at a 1/20 dilution.

References

ab184780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab184780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up