Anti-C15orf42 antibody - N-terminal (ab190182)

Overview

  • Product name
    Anti-C15orf42 antibody - N-terminal
    See all C15orf42 primary antibodies
  • Description
    Rabbit polyclonal to C15orf42 - N-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human C15orf42 aa 1-350.
    Sequence:

    MACCHKVMLLLDTAGGAARHSRVRRAALRLLTYLSCRFGLARVHWAFKFF DSQGARSRPSRVSDFRELGSRSWEDFEEELEARLEDRAHLPGPAPRATHT HGALMETLLDYQWDRPEITSPTKPILRSSGRRLLDVESEAKEAEAALGGL VNAVFLLAPCPHSQRELLQFVSGCEAQAQRLPPTPKQVMEKLLPKRVREV MVARKITFYWVDTTEWSKLWESPDHLGYWTVCELLHHGGGTVLPSESFSW DFAQAGEMLLRSGIKLSSEPHLSPWISMLPTDATLNRLLYNSPEYEASFP RMEGMLFLPVEAGKEIQETWTVTLEPLAMHQRHFQKPVRIFLKGSVAQWS


    Database link: Q7Z2Z1

  • Positive control
    • U2OS cells transfected with C15orf42 siRNA, U2OS, mouse embryo fibroblasts and rat INS1 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Purity
    Whole antiserum
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 211 kDa.

Target

  • Function
    Regulator of DNA replication and S/M and G2/M checkpoints. Regulates the triggering of DNA replication initiation via its interaction with TOPBP1 by participating to CDK2-mediated loading of CDC45L onto replication origins. Required for the transition from pre-replication complex (pre-RC) to pre-initiation complex (pre-IC). Required to prevent mitotic entry after treatment with ionizing radiation.
  • Sequence similarities
    Belongs to the treslin family.
  • Cellular localization
    Nucleus. Associates with chromatin.
  • Information by UniProt
  • Database links
  • Alternative names
    • C15orf42 antibody
    • chromosome 15 open reading frame 42 antibody
    • replication-stimulating protein antibody
    • SLD3 antibody
    • SLD3 homolog antibody
    • SLD3, yeast , homolog of antibody
    • TICRR antibody
    • TICRR_HUMAN antibody
    • TopBP1-interacting antibody
    • TopBP1-interacting checkpoint and replication regulator antibody
    • Treslin antibody
    see all

Images

  • All lanes : Anti-C15orf42 antibody - N-terminal (ab190182) at 1/2000 dilution

    Lane 1 : Human U2OS cell lysate
    Lane 2 : Human U2OS cell lysate transfected with C15orf42 siRNA
    Lane 3 : Mouse embryo fibroblasts (MEFs) cell lysate
    Lane 4 : Rat INS1 cell lysate

    Lysates/proteins at 30 µg per lane.

    Predicted band size: 211 kDa

References

ab190182 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up