Overview

  • Product name
  • Description
    Rabbit polyclonal to C16orf65
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 (

    STPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISIS

    ) of Human C16orf65 (NP_776167).

  • Positive control
    • Human fetal small intestine lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • C25H16orf65 antibody
    • Chromosome 16 open reading frame 65 antibody
    • Hypothetical protein LOC255762 antibody
    • MGC134002 antibody
    • MGC50721 antibody
    • PDZ domain containing 9 antibody
    • PDZ domain containing protein C16orf65 antibody
    • PDZ domain-containing protein 9 antibody
    • PDZ domain-containing protein C16orf65 homolog antibody
    • Pdzd9 antibody
    • PDZD9_HUMAN antibody
    see all

Anti-C16orf65 antibody images

  • Anti-C16orf65 antibody (ab90161) at 1 µg/ml + Fetal small intestine lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 23 kDa

References for Anti-C16orf65 antibody (ab90161)

ab90161 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up