Overview

  • Product name
    Anti-C16orf65 antibody
  • Description
    Rabbit polyclonal to C16orf65
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 72-121 (

    STPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISIS

    ) of Human C16orf65 (NP_776167).

  • Positive control
    • Human fetal small intestine lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similarities
    Contains 1 PDZ (DHR) domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • C25H16orf65 antibody
    • Chromosome 16 open reading frame 65 antibody
    • Hypothetical protein LOC255762 antibody
    • MGC134002 antibody
    • MGC50721 antibody
    • PDZ domain containing 9 antibody
    • PDZ domain containing protein C16orf65 antibody
    • PDZ domain-containing protein 9 antibody
    • PDZ domain-containing protein C16orf65 homolog antibody
    • Pdzd9 antibody
    • PDZD9_HUMAN antibody
    see all

Images

  • Anti-C16orf65 antibody (ab90161) at 1 µg/ml + Fetal small intestine lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 23 kDa

References

ab90161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab90161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up