Anti-C16orf73 antibody - C-terminal (ab178756)

Overview

  • Product name
    Anti-C16orf73 antibody - C-terminal
    See all C16orf73 primary antibodies
  • Description
    Rabbit polyclonal to C16orf73 - C-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Horse, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human C16orf73 aa 264-313 (C terminal). The exact sequence is proprietary.
    Sequence:

    ANILLNFIRENKETNVLDDEIDSYFKESINLSTIVDVYTVEQLKGKALKN


    Database link: Q8N635

  • Positive control
    • Human uterus tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab178756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml.

Target

Images

  • Anti-C16orf73 antibody - C-terminal (ab178756) at 1 µg/ml + Human uterus tumor lysate at 10 µg

References

ab178756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab178756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up